SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025729 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025729
Domain Number 1 Region: 528-789
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.25e-66
Family Ankyrin repeat 0.0000135
Further Details:      
 
Domain Number 2 Region: 27-319
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.85e-66
Family Ankyrin repeat 0.0000268
Further Details:      
 
Domain Number 3 Region: 953-1156
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.63e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0022
Further Details:      
 
Domain Number 4 Region: 356-556
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.32e-37
Family Ankyrin repeat 0.0004
Further Details:      
 
Domain Number 5 Region: 874-935
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000196
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025729   Gene: ENSMUSG00000024811   Transcript: ENSMUST00000025729
Sequence length 1166
Comment pep:known chromosome:NCBIM37:19:36908722:36967967:1 gene:ENSMUSG00000024811 transcript:ENSMUST00000025729
Sequence
MSGRRCAGGGAACASAGAEAVEPSARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKST
PLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLQHGADPNAR
DNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGDYKKDE
LLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLHHGADVHAK
DKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRIEVCSLLLSYG
ADPTLLNCHNKSAIDLAPTAQLKERLSYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKH
PQTHETALHCAAASPYPKRKQICELLLRKGANTNEKTKEFLTPLHVASENAHNDVVEVVV
KHEAKVNALDSLGQTSLHRAAHCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQL
LQEGASLGHSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVS
VVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAA
AKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLAR
VKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAA
SYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQT
PLDLVSADDVSALLTAAMPPSALPTCYKPQVLSGVRGPGATADALSSGPSSPSSLSAASS
LDNLSGSFSELSAVVSSSAAEGATGLQRKEDSGIDFSITQFIRNLGLEHLMDIFEREQIT
LDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNNSGSGTILIDLSP
DDKEFQSVEEEMQSTVREHRDGGHAGGVFNRYNILKIQKVCNKKLWERYTHRRKEVSEEN
HNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTG
CPIHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYV
IYRGEQAYPEYLITYQIVRPEGMVDG
Download sequence
Identical sequences Q3UES3
ENSMUSP00000025729 ENSMUSP00000025729 10090.ENSMUSP00000025729 NP_001157107.1.92730 ENSMUSP00000025729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]