SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025986 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025986
Domain Number 1 Region: 151-345
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.85e-60
Family Astacin 0.0000888
Further Details:      
 
Domain Number 2 Region: 465-570
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-37
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 617-727
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 778-884
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-35
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 5 Region: 352-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-35
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 6 Region: 908-1001
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-28
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 7 Region: 728-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000184
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 572-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000236
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025986   Gene: ENSMUSG00000025013   Transcript: ENSMUST00000025986
Sequence length 1012
Comment pep:known chromosome:NCBIM37:19:41158471:41281264:-1 gene:ENSMUSG00000025013 transcript:ENSMUST00000025986
Sequence
MPLATTLGTLVLLLLLPLPRGAEVTGDHSNVALDYGALEGEEGTEQQLHYHDPCKAAVFW
GDIALDEDDLKLFHIDKAEDWTKPSIDKPGHDTGGLEETSARWPNDTASNASIQAPRKDG
KDATTFLPNPGTSNTTAKTFSARVRRATTSRTERIWPGGVIPYVIGGNFTGTQRAIFKQA
MRHWEKHTCVTFVERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHE
LGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYAR
NTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNFS
APGFPNGYPSYSHCVWRISVTPGEKIILNFTSMDLFKSRLCWYDYVEIRDGYWRKAPLLG
RFCGDKIPESLVSSDSRLWVEFRSSSSSLGKGFFAVYEAMCGGDITKDAGQIQSPNYPDD
YRPSKECVWRITVPDGFHVGLTFQSFEIERHDSCAYDYLEIRDGPTEDSTLIGHFCGYEK
PEAVKSSANRLWVKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEQRCVNTLGSYTCAC
DPGYELAADKKTCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPVQYRISLQFE
AFELEGNDVCKYDFVEVRSGLSPDAKLHGKFCGSETPEVITSQSNNMRVEFKSDNTVSKR
GFRAHFFSDKDECAKDNGGCQQECVNTFGSYLCRCRNGYRLHENGHDCKEAGCAYKISSA
EGTLMSPNWPDKYPSRKECTWNISSTAGHRVKITFSEFEIEQHQECAYDHLELYDGTDSL
APILGRFCGSKKPDPVVATGSSLFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKELY
SHAQFGDNNYPSQARCDWVIVAEDGYGVELIFRTFEVEEEADCGYDFMEAYDGYDSSAPR
LGRFCGSGPLEEIYSAGDSLMIRFHTDDTINKKGFHARYTSTKFQDALHMRK
Download sequence
Identical sequences Q9WVM6
ENSMUSP00000025986 NP_036034.1.92730 ENSMUSP00000025986 10090.ENSMUSP00000025986 ENSMUSP00000025986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]