SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026170 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026170
Domain Number 1 Region: 129-219
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.53e-20
Family Ubiquitin-related 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026170   Gene: ENSMUSG00000025171   Transcript: ENSMUST00000026170
Sequence length 227
Comment pep:known chromosome:NCBIM37:19:42056253:42109131:1 gene:ENSMUSG00000025171 transcript:ENSMUST00000026170
Sequence
MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPA
FEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCL
SPPVNLLLEHTEEESLEPPEPTPSVRREFPLKVRLSTGKDVRLNASLPDTVGQLKRQLHS
QEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
Download sequence
Identical sequences Q91WB7
ENSMUSP00000026170 NP_663475.1.92730 XP_021064176.1.100879 XP_021517082.1.76796 ENSMUSP00000026170 ENSMUSP00000026170 MmR40 10090.ENSMUSP00000026170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]