SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026352 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026352
Domain Number 1 Region: 1029-1313
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.16e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000131
Further Details:      
 
Domain Number 2 Region: 467-624
Classification Level Classification E-value
Superfamily Fibronectin type III 4.87e-18
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 3 Region: 156-288
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000103
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 4 Region: 336-449
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000459
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 5 Region: 641-735,821-888
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000641
Family Fibronectin type III 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000026352
Domain Number - Region: 732-810
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00254
Family Fibronectin type III 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026352   Gene: ENSMUSG00000025314   Transcript: ENSMUST00000026352
Sequence length 1350
Comment pep:known chromosome:NCBIM37:2:90273046:90420804:-1 gene:ENSMUSG00000025314 transcript:ENSMUST00000026352
Sequence
MTRGGGRGSSRGRGSRELGATRGGWAPLAPPREAPASLRPRPLRARRARLRRVAAAAAAA
MSPGKPGAGGAGTRRTGWRRRRRRRRLETETRAPGFGHTAGRVPGTFQGAQGMKPAARET
RTPPRSPGLRWALLPLLLLLRQGQVLCAGAAPNPIFDIEAVVSPTSVLLTWKHNDSGASE
CRIENKMESNLTFPVKNQTSCNITGLSPGTSYTFSIISVTTNETLNKTITTEPWPVSDLH
VTSVGVTQARLTWSNANGTASYRMLIEELTTHSSVNISGLKPGTNNSFAFPESNETQADF
AVAEEVPDANGTKRIPVTNLSQLHKNSLVSVDPPSGQDPSLTEILLTDLKPDTQYNATIY
SQAANGTEGQPRNKVFKTNSTQVSDVRAMNISASSMTLTWKSNYDGSRTSIVYKIHVAGG
THSVNQTVNKTEAIILGLSSSTLYNITVHPFLGQTEGTPGFLQVYTSPDQVSDFRVTNVS
TRAIGLAWRSNDSKSFEIFIKQDGGEKHRNASTGNQSYMVEDLKPGTSYHFEIIPRGPDG
TEGLSSTVNGSTDPSAVTDIRVVNISTTEMQLEWQNTDDASGYTYHLVLESKSGSIIRTN
SSQKWITVGSLTPGTLYNVTIFPEVDQIQGISNSITQYTRPSSVSHIEVNTTTTTAAIRW
KNEDAASASYAYSVLILKTGDGSNVTSNFTKDPSILIPELIPGVSYTVKILTQVGDGTTS
LVPGWNLFCTEPEPVTSFHCEVVPKEPALVLKWACPFGMYTGFELGVRSDSWDNMTRLEN
CTSDDDTECRTEVAYLNFSTSYNISIATLSCGKMALPAQNICTTGITDPPTPDGSPNITS
VSHNSVKVKFSGFEASHGPIKAYAVILTTGEAAQPSADVLKYTYEDFKRGASDTYVTYLI
RIEEKGQSQGLSEVLNYEIDVGNQSTTLGYYNGRLEPLGSYRACVAGFTNITYNLQNDGL
INGDESYVSFSPYSEAVFLPQDPGVICGAVFGCIFGALAITAVGGFIFWRKKRTDAKNNE
VSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEIAENRG
KNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMV
WEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEVVLPEWTIRDFVVKNM
QNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTG
TFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIIRAQKDSKV
DLIYQNTTAMTIYENLEPVSMFGKTNGYIA
Download sequence
Identical sequences E9Q4S7
ENSMUSP00000129592 ENSMUSP00000026352 ENSMUSP00000129592 NP_033008.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]