SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026414 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026414
Domain Number 1 Region: 372-609,642-712
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.8e-50
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 1-119
Classification Level Classification E-value
Superfamily EF-hand 6.74e-45
Family EF-hand modules in multidomain proteins 0.000027
Further Details:      
 
Domain Number 3 Region: 91-183
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000101
Family Calmodulin-like 0.025
Further Details:      
 
Domain Number 4 Region: 188-254
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000133
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Domain Number 5 Region: 260-325
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000807
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026414   Gene: ENSMUSG00000025357   Transcript: ENSMUST00000026414
Sequence length 730
Comment pep:known chromosome:NCBIM37:10:128157197:128181112:-1 gene:ENSMUSG00000025357 transcript:ENSMUST00000026414
Sequence
MAKEKGLISPEDFAQLQKYIEYSTKRVSDVLKVFDDGEMNRFCQGDAIGYLGFEQFMKMY
LEMEEVPHHLCWALFWSFHTSQVAAEKTKSKANVICLSDVYCYFTLLEGGRPEDKLEFTF
KLYDMDRNGILDSTEVEKIILQMMRVAEYLDWDVSELRPILQEMMREMDQDGSGSVSLDE
WVRAGATTVPLLVLLGMDVTMKDDGNHIWRPKRFTRLVYCNLCEQSISLGKQGLSCNFCK
YIVHDHCAMKAQPCEVSTYAKSRKDIGVQSHLWVRGGCHSGRCDRCQKKIRTYHSLTGLH
CVWCHLEIHDDCLQAVGPECDCGLLRDHILPPCSIYPSVLVSGQECKHKTTDDTSLCTPE
AFRIEPVSNTHPLLVFINLKSGGKQGQSVLWKFQYILNPRQVFDLKDGPEPGLRFFKDVP
QFRILVCGGDGTVGWVLETIDKANFATVPPVAVLPLGTGNDLARCLRWGRGYEGENLRKI
LKDIELSKVVYLDRWFLEVIPQQNGEKSDPVPSQIINNYFSIGVDASIAHRFHLMREKYP
EKFNSRMKNKLWYFEFATSESIFSTCKKLEESVTVEICGKLLDLSDLSLEGIAVLNIPST
HGGSNLWGDTKRPHGDTCEINQALGSAAKIITDPDILKTCVPDMSDKRLEVVGIEGAIEM
GQIYTRLKSAGHRLAKCSEITFQTTKTLPMQIDGEPWMQAPCTIKITHKNQMPMLMGPPS
NSYNFFGFWS
Download sequence
Identical sequences O88673
ENSMUSP00000026414 NP_058091.2.92730 XP_011241653.1.92730 XP_011241662.1.92730 XP_017169275.1.92730 XP_017169276.1.92730 XP_017169277.1.92730 ENSMUSP00000026414 10090.ENSMUSP00000026414 ENSMUSP00000026414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]