SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026607 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026607
Domain Number 1 Region: 4-457,569-624
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-80
Family GDI-like N domain 0.000000000000152
Further Details:      
 
Domain Number 2 Region: 457-568
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.08e-40
Family GDI-like 0.000000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026607   Gene: ENSMUSG00000025531   Transcript: ENSMUST00000026607
Sequence length 662
Comment pep:known chromosome:NCBIM37:X:110154204:110299126:-1 gene:ENSMUSG00000025531 transcript:ENSMUST00000026607
Sequence
MADNLPSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQENSDVVTENSMWQEQILENEEAILLSSKDKTIQHVEVFCYASQDLHKDVEEAGALQK
NPASVMSAQATEAAEAAEAAEAAEATEAAEAACLPTAEESLSTRSCELPAEQSQCTGPES
SPQVNDAEVGEKETQSDAKSSTEQSSEILPKVQDNTETPKRNVITYSQIIKEGRRFNIDL
VSKLLYSRGLLIDLLIKSNVSRYAEFKNITRILAFREGTVEQVPCSRADVFNSKQLTMVE
KRMLMKFLTFCVEYEDHPDEYKAYEETTFSEYLKTQKLTPNLQYFVLHSIAMTSETTSST
VDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDK
ESRKCKAIVDQFGQRIISKHFVIEDSYLSENTCSGVQYRQISRAVLITDGSVLKPDSDQQ
VSILTVPAEESGSFAVRVIELCSSTMTCMKGTYLVHLTCMSSKTAREDLERVVQKLFTPY
TEIEAENEQVEKPRILWALYFNMRDSSDISRDCYNDLPSNVYVCSGPDCNLGNDNAVQQA
ETVFQKICPNEDFCPAPPNPEDIILDGDSSQQEVSESSVIPETNSETPKESTVLGDSEEP
SE
Download sequence
Identical sequences A2AD03
NP_061288.2.92730 ENSMUSP00000026607 ENSMUSP00000026607 ENSMUSP00000026607 10090.ENSMUSP00000026607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]