SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026635 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026635
Domain Number 1 Region: 541-749
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-45
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 223-367
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-41
Family Third domain of FERM 0.00027
Further Details:      
 
Domain Number 3 Region: 879-1031
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-33
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 4 Region: 739-862
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-27
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 5 Region: 123-225
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-27
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 6 Region: 41-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-23
Family First domain of FERM 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026635   Gene: ENSMUSG00000025555   Transcript: ENSMUST00000026635
Sequence length 1048
Comment pep:known chromosome:NCBIM37:14:121434786:121682966:1 gene:ENSMUSG00000025555 transcript:ENSMUST00000026635
Sequence
MGEIEQKPTPASRLGAPENSGISTLERGQKPPPTPSGKLMTVKIQMLDDTQEAFEVPQRA
PGKVLFDAVCNHLNLVEGDYFGLEFPDHRKIVVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHL
AKNKYVPQQDALEDRIMEFHHSHVGQTPAESDFQLLEVARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDVNSSYQDTLEFLMAGRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSTRSLVSQPTAPNSEVPKQSPQSASLTFGEGTESPGGQSCQQAKETKACTL
ELGPHQSPALPKSPPGSKAADGTTVVPPEEEEEEEGGKDGIRPSNPQPPQPSTGSLTGSP
HLSELSINSQGGAAPANVTLSPNLSPDNKQASPLISPLLNDQACPRTDDEEEGRRKRFPT
DKAYYIAKEVSTTERTYLKDLEVIASWFQSTVSKEDSMPEALKSLIFPNFEPLHKFHTNF
LKEIEQRLALWEGRSNAHVRGDYQRIGDVMLKNIQGMKHLAAHLWKHSEALEALETSIKG
SRRLEHFCRDFELQKVCYLPLNTFLLRPLHRLMHYKHVLERLCKHHPPNHADFRDCRAAL
AEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVTPGREFIRLGSLSKLSGKGLQQR
MFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEEEWGVPHCLTLRGQRQSIIVA
ASSRSEMEKWMEDIQMAIDLAEKSNGPTPELLASSPPDNKSPDEATAADQESEDDLSASR
TSLERQAPHRGNTMVHVCWHRSTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFT
NFCLFFYKSHQDSHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAESEYTF
ERWMEVIRSATSSASRAHILSHKESHLY
Download sequence
Identical sequences F8VPU2
ENSMUSP00000026635 ENSMUSP00000116985 NP_598843.3.92730 XP_006518977.1.92730 ENSMUSP00000026635 10090.ENSMUSP00000026635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]