SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027302 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027302
Domain Number 1 Region: 42-296
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.25e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027302   Gene: ENSMUSG00000026126   Transcript: ENSMUST00000027302
Sequence length 453
Comment pep:known chromosome:NCBIM37:1:34516591:34530620:1 gene:ENSMUSG00000026126 transcript:ENSMUST00000027302
Sequence
MSRHTDLVRSFLEQLEARDYREGAILAREFSDIKARSVAWKSEGVCSTKAGSRLGNTNKN
RYKDVVAYDETRVILSLLQEEGHGDYINANFIRGIDGSQAYIATQGPLPHTLLDFWRLVW
EFGVKVILMACQETENGRRKCERYWAREQEPLKAGPFCITLTKETTLNADITLRTLQVTF
QKEFRSVHQLQYMSWPDHGVPSSSDHILTMVEEARCLQGLGPGPLCVHCSAGCGRTGVLC
AVDYVRQLLLTQTIPPNFSLFQVVLEMRKQRPAAVQTEEQYRFLYHTVAQLFSRTLQDTS
PHYQNLKENCAPICKEAFSLRTSSALPATSRPPGGVLRSISVPAPPTLPMADTYAVVQKR
GASAGTGPGPRAPTSTDTPIYSQVAPRAQRPVAHTEDAQGTTALRRVPADQNSSGPDAYE
EVTDGAQTGGLGFNLRIGRPKGPRDPPAEWTRV
Download sequence
Identical sequences Q61152
10090.ENSMUSP00000027302 NP_035336.2.92730 ENSMUSP00000027302 ENSMUSP00000027302 ENSMUSP00000027302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]