SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027517 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027517
Domain Number 1 Region: 320-454,762-935
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.09e-51
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 52-175
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-28
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 3 Region: 1147-1213
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.71e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 221-290
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.93e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000261
Further Details:      
 
Domain Number 5 Region: 161-217
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000508
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027517   Gene: ENSMUSG00000070738   Transcript: ENSMUST00000027517
Sequence length 1220
Comment pep:known chromosome:NCBIM37:1:89749862:89841064:1 gene:ENSMUSG00000070738 transcript:ENSMUST00000027517
Sequence
MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTILKEGML
TKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
CRKLILCADNRKEMEDWIAALKTVQNKEHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REVLSGVTSHGLSCEVCKFKAHKRCAVRATSNCKWTTLASIGKDIIEDEDGIAMPHQWLE
GNLPVSAKCIVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLVMKCPLGLCKVSVIPPTA
LNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILAKLERASTKMLDRWSVMAYETKLPRQASSSTVTEDFSEDSEVQQILFY
EDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSQESEVMAKKCS
VLKEKLDSLLKTLDDESQASSSLSNPPPTIAEEAEDGDGSGNICSSTGDHLVGSACPSRP
QIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQQGFVLGLSESEKKDLKTDN
RVCTSSVHSESCVIAKGRSQRKASRAPCEKLVSKGLSLGSSASLPPGTGSRDSLPALNTK
ILYPSVRAGMSGSLPGGSVISRLLINADPFNAEPENLEYYTEKCVMNNYFGIGLDAKISL
DFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYRNLEQKVLLECDGRPIPLPSLQGI
AVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIKLQHHRIAQ
CRTVKISILGDEGVPVQVDGEAWIQPPGYIRIVHKNRAQTLTRDRAFENTLKSWEDKQKC
ELSRPPSFSLHPEILSEEEATQMDQFGQAAGGLIHSIREIAQSHRAMEQELAHAVNASSK
AMERVYGKPRTAEGLNCSFVLEMVNNIRALRSETELLLAGKMALQLDPPQKERLGAALIE
MDQQLRKLTDTPWLCQPLEPGEEESLQQNVMLDLTKRSRSGKFRLVTKFKKEKNNKNKEV
HSNLGGPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGH
MKRILCGIKELSRSSPAAEA
Download sequence
Identical sequences E9PUQ8
ENSMUSP00000027517 NP_808314.2.92730 ENSMUSP00000027517 ENSMUSP00000027517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]