SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027603 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027603
Domain Number 1 Region: 76-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.27e-45
Family Regulator of G-protein signaling, RGS 0.000000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027603   Gene: ENSMUSG00000026357   Transcript: ENSMUST00000027603
Sequence length 235
Comment pep:known chromosome:NCBIM37:1:146599813:146622565:-1 gene:ENSMUSG00000026357 transcript:ENSMUST00000027603
Sequence
MDMSLVFFSQLNMCESKEKTFFKLMHGSGKEETSIEAKIRAKEKRNRLSLLLQRPDFHGE
TQASRSALLAKETRVSPEEAVKWAESFDKLLSHRDGVDAFTRFLKTEFSEENIEFWVACE
DFKKCKEPQQIILKAKAIYEKFIQNDAPKEVNIDFHTKEVIAKSIAQPTLHSFDTAQSRV
YQLMEHDSYKRFLKSETYLHLIEGRPQRPTNLRRRSRSFTYNDFQDVKSDVAIWL
Download sequence
Identical sequences Q544K2 Q99PG4
ENSMUSP00000027603 NP_075019.1.92730 ENSMUSP00000027603 ENSMUSP00000027603 10090.ENSMUSP00000027603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]