SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027748 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027748
Domain Number 1 Region: 54-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.09e-44
Family Regulator of G-protein signaling, RGS 0.000000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027748   Gene: ENSMUSG00000026475   Transcript: ENSMUST00000027748
Sequence length 201
Comment pep:known chromosome:NCBIM37:1:155587479:155592598:1 gene:ENSMUSG00000026475 transcript:ENSMUST00000027748
Sequence
MCRTLATFPNTCLERAKEFKTRLGIFLHKSELSSDTGGISKFEWASKHNKERSFSEDVLG
WRESFDLLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFDEY
IRSEAPKEVNIDHETRELTKTNLQAATTSCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLA
AQASATSTSAPSGSPAEPSHT
Download sequence
Identical sequences P97428 Q542U0
ENSMUSP00000027748 10090.ENSMUSP00000027748 ENSMUSP00000027748 NP_035397.2.92730 ENSMUSP00000027748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]