SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027997 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027997
Domain Number 1 Region: 53-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.16e-47
Family Regulator of G-protein signaling, RGS 0.00000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027997   Gene: ENSMUSG00000026678   Transcript: ENSMUST00000027997
Sequence length 181
Comment pep:known chromosome:NCBIM37:1:171585632:171625944:1 gene:ENSMUSG00000026678 transcript:ENSMUST00000027997
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKAHKPSLEEVLQ
WRQSLDKLLQNSYGFASFKSFLKSEFSEENLEFWVACENYKKIKSPIKMAEKAKQIYEEF
IQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRIYALMEKDSLPRFVRSEFYKELI
K
Download sequence
Identical sequences O08850
NP_033089.2.92730 10090.ENSMUSP00000027997 ENSMUSP00000027997 ENSMUSP00000027997 ENSMUSP00000027997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]