SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028010 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028010
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-57
Family FAD/NAD-linked reductases, N-terminal and central domains 0.004
Further Details:      
 
Domain Number 2 Region: 312-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000199
Family FAD/NAD-linked reductases, N-terminal and central domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028010   Gene: ENSMUSG00000026691   Transcript: ENSMUST00000028010
Sequence length 534
Comment pep:known chromosome:NCBIM37:1:164883933:164914658:-1 gene:ENSMUSG00000026691 transcript:ENSMUST00000028010
Sequence
MKKKVAIIGAGVSGLAAIRSCLEEGLEPTCFERSDDVGGLWKFSDHIEEGRASIYQSVFT
NSSKEMMCFPDFPYPDDFPNFMHHSKLQEYITSFAKEKNLLKYIQFETPVTSINKCPNFS
TTGKWEVTTEKHGKKETAVFDATMICSGHHIFPHVPKDSFPGLNRFKGKCFHSRDYKEPG
IWKGKRVLVIGLGNSGCDIAAELSHVAQKVTISSRSGSWVMSRVWDDGYPWDMVVLTRFQ
TFLKNNLPTAISDWWYTRQMNARFKHENYGLVPLNRTLRKEPVFNDELPARILCGMVTIK
PNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNEVTLYKGVFPPQ
LEKPTMAVIGLVQSLGATIPITDLQARWAAQVIKGTCTLPSVNDMMDDIDEKMGEKFKWY
GNSTTIQTDYIVYMDELASFIGAKPNLLWLFLKDPRLAVEVFFGPCSPYQFRLVGPGKWS
GARNAILTQWDRSLKPMKTRVVSKVQKSCSHFYSRLLRLLAVPVLLIALFLVLI
Download sequence
Identical sequences P97501 Q3UEN4
ENSMUSP00000028010 10090.ENSMUSP00000028010 NP_032056.1.92730 ENSMUSP00000028010 ENSMUSP00000028010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]