SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028014 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028014
Domain Number 1 Region: 3-223
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0043
Further Details:      
 
Domain Number 2 Region: 299-483
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000531
Family FAD/NAD-linked reductases, N-terminal and central domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028014   Gene: ENSMUSG00000026692   Transcript: ENSMUST00000028014
Sequence length 560
Comment pep:known chromosome:NCBIM37:1:164724014:164742680:-1 gene:ENSMUSG00000026692 transcript:ENSMUST00000028014
Sequence
MAKKVAVIGAGVSGLSSIKCCLDENLEPTCFERTSDFGGLWKFADTSEDGMTRVYRSLVT
NVCKEMSCYSDFPFREDYPNFMSHEKFWDYLREFAEHFGLLRYIRFKTTVLSVTKRPDFS
ETGQWDVVTETEGKRDRAVFDAVMVCTGQFLSPHLPLESFPGIHKFKGQILHSQEYRIPD
AFRGKRILVVGLGNTGGDIAVELSEIAAQVFLSTRTGTWVLSRSSPGGYPFNMIQTRWLN
FLVRVLPSRFINWTHERKMNKILNHENYGLSIAKGKKPKFIVNDELPTCILCGKVTMKTS
VKDFTESSVIFEDGTTEANIDVVIFTTGYEFSFPFFEEPLKSLCTKKIILYKRVFPPNLE
RATLAIIGLISLNGSILVGTEFQARWATRVFKGLCSIPPSQKLMAEATKTEQLIKRGVIK
DTSQDKLDFITYMDELTQCIGAKPSIPLLFIKDPRLAWEVFFGPCTPYQYRLVGPGRWDG
ARNAILTQWDRTLKPLKTRIVPKSPEPTSLSHYLIAWGAPVLLVSLLLIYKSSHFLELVQ
GKLPRRFPPYRLLWYMPQNS
Download sequence
Identical sequences Q8VHG0
ENSMUSP00000028014 NP_659127.1.92730 XP_006496839.1.92730 XP_006496840.1.92730 10090.ENSMUSP00000028014 ENSMUSP00000028014 ENSMUSP00000107150 ENSMUSP00000028014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]