SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028132 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028132
Domain Number 1 Region: 34-185
Classification Level Classification E-value
Superfamily L domain-like 7.29e-30
Family Ngr ectodomain-like 0.076
Further Details:      
 
Domain Number 2 Region: 573-631
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000449
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 
Domain Number 3 Region: 671-720
Classification Level Classification E-value
Superfamily RING/U-box 0.00000205
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028132   Gene: ENSMUSG00000026792   Transcript: ENSMUST00000028132
Sequence length 727
Comment pep:known chromosome:NCBIM37:2:32780744:32816771:-1 gene:ENSMUSG00000026792 transcript:ENSMUST00000028132
Sequence
MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVL
IVHTNHLTSLLPKSCSLLSLVTIKVLDLHENQLTALPDDMGQLTVLQVLNVERNQLTHLP
RSIGNLLQLQTLNVKDNKLKELPDTLGELRSLRTLDISENEIQRLPQMLAHVRTLETLSL
NALAMVYPPPEVCGAGTAAVQQFLCKESGLDYYPPSQYLLPVLEQDGAENTQDSPDGPAS
RFSREEAEWQNRFSDYEKRKEQKMLEKLEFERRLDLGQREHAELLQQSHSHKDEILQTVK
QEQTRLEQDLSERQRCLDAERQQLQEQLKQTEQSIASRIQRLLQDNQRQKKSSEILKSLE
NERIRMEQLMSITQEETENLRQREIAAAMQQMLTESCKSRLIQMAYESQRQSLAQQACSS
MAEMDKRFQQILSWQQMDQNKAISQILQESVMQKAAFEALQVKKDLMHRQIRNQIRLIET
ELLQLTQLELKRKSLDTETLQEMVSEQRWALSNLLQQLLKEKKQREEELHGILAELEAKS
ETKQENYWLIQYQRLLNQKPLSLKLQEEGMERRLVALLVELSAEHYLPLFAHHRISLDML
SRMSPGDLAKVGVSEAGLQHEILRRAQDLLAVPRVQPELKPLENEVLGALEPPTAPRELQ
ESVRPSAPPAELDMPTSECVVCLEREAQMVFLTCGHVCCCQQCCQPLRTCPLCRQEISQR
LRIYHSS
Download sequence
Identical sequences Q80ZI6
ENSMUSP00000028132 NP_955006.1.92730 XP_006498032.1.92730 XP_006498033.1.92730 XP_006498034.1.92730 XP_006498035.1.92730 ENSMUSP00000028132 ENSMUSP00000108825 ENSMUSP00000028132 10090.ENSMUSP00000028132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]