SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028252 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028252
Domain Number 1 Region: 424-535
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-32
Family SH2 domain 0.00000612
Further Details:      
 
Domain Number 2 Region: 101-196
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-29
Family Ras-binding domain, RBD 0.00045
Further Details:      
 
Domain Number 3 Region: 227-341
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-16
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028252   Gene: ENSMUSG00000026888   Transcript: ENSMUST00000028252
Sequence length 538
Comment pep:known chromosome:NCBIM37:2:64750533:64860839:-1 gene:ENSMUSG00000026888 transcript:ENSMUST00000028252
Sequence
MTTSLQDGQSAAGRAGAQDSPLAVQVCRVAQGKGDAQDPAQVPGLHALSPASDATLRGAI
DRRKMKDLDVLEKPPIPNPFPELCCSPLTSVLSAGLFPRANSRKKQVIKVYSEDETSRAL
EVPSDITARDVCQLLILKNHYVDDNSWTLFEHLSHIGLERTVEDHELPTEVLSHWGVEED
NKLYLRKNYAKYEFFKNPMYFFPEHMVSFAAEMNGDRSPTQILQVFLSSSTYPEIHGFLH
AKEQGKKSWKKAYFFLRRSGLYFSTKGTSKEPRHLQLFSEFSTSHVYMSLAGKKKHGAPT
PYGFCLKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKDGMQLYQNYMHPYQGRSACNS
QSMSPMRSVSENSLVAMDFSGEKSRVIDNPTEALSVAVEEGLAWRKKGCLRLGNHGSPSA
PSQSSAVNMALHRSQPWFHHRISRDEAQRLIIRQGPVDGVFLVRDSQSNPRTFVLSMSHG
QKIKHYQIIPVEDDGELFHTLDDGHTKFTDLIQLVEFYQLNRGVLPCKLKHYCARMAV
Download sequence
Identical sequences A2ASX2 Q9JLM9
ENSMUSP00000028252 ENSMUSP00000028252 NP_057928.1.92730 ENSMUSP00000028252 10090.ENSMUSP00000028252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]