SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028368 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028368
Domain Number 1 Region: 50-311
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-54
Family WD40-repeat 0.00045
Further Details:      
 
Domain Number 2 Region: 389-473
Classification Level Classification E-value
Superfamily RING/U-box 1.27e-24
Family U-box 0.0019
Further Details:      
 
Domain Number 3 Region: 328-396
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.21e-16
Family SAM (sterile alpha motif) domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000028368
Domain Number - Region: 5-43
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0915
Family Nitrous oxide reductase, N-terminal domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028368   Gene: ENSMUSG00000026988   Transcript: ENSMUST00000028368
Sequence length 474
Comment pep:known chromosome:NCBIM37:2:59690421:59720641:-1 gene:ENSMUSG00000026988 transcript:ENSMUST00000028368
Sequence
MVRLIHTLADHGDDVSCCAFSAALLATCSLDKTIRLYSLSDFAELPYSPLKFHTYAVHCC
CFSPSGHVLASCSTDGTTVLWSSHSGHTLTVLEQPGGSPVRVCCFSPDSAYLASGAADGS
IALWNAQTYKLYRCGSVKDSSLVACAFSPDGGLFVTGSSGGDLTVWDDRMRCLHSEKAHD
LGITCCSFSSQPLSGGEGLQSYQLASCGQDCEIKLWAVTITRVLGFELKYKSTLSGHCAP
VLACAFSHDGKMLASGSVDKSVIIHGIGPQSVLHTLTQHTRYVTTCAFAPNTLLLATGSM
DKTVNIWQFDLETPCQGSMNDPLKHFTEEWSEEDVSVWLRAQGLEDLVGIFRANNIDGKE
LLHLTKESLAGDLKIESLGLRSKVLRSIEELRAKMDSLSSGIPDEFICPITRELMKDPVI
ASDGYSYEREAMESWIHKKKRTSPMTNLALPSLVLTPNRTLKMAINRWLETHEK
Download sequence
Identical sequences Q9D0I6
NP_082394.1.92730 XP_006500286.1.92730 ENSMUSP00000028368 ENSMUSP00000028368 MmR132 mmt007007659.1 mmt007007659.2 mmt007007659.3 ENSMUSP00000028368 10090.ENSMUSP00000028368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]