SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028814 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028814
Domain Number 1 Region: 192-249
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000031
Family Ras-binding domain, RBD 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000028814
Domain Number - Region: 245-310
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0379
Family C-terminal domain of PLC-beta 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028814   Gene: ENSMUSG00000027339   Transcript: ENSMUST00000028814
Sequence length 326
Comment pep:known chromosome:NCBIM37:2:131815151:131855737:-1 gene:ENSMUSG00000027339 transcript:ENSMUST00000028814
Sequence
MDYTHQPALIPCGQDKYMPKSELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISW
GLRRPIRLQMQDDHERIRPPPSSSSWHSGCNLGAQGTTLKPLTMPTVQISEVDMPVEGLE
THSPTDSRGLKPVQEDTPQLMRTRSDVGVRRRGNVRTSSDQRRIRRHRFSINGHFYNHKT
SVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQRLKSSDY
PLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVEK
LMRKYTVLRLMIRQRLEEIAETPETI
Download sequence
Identical sequences Q8BMS9
ENSMUSP00000028814 ENSMUSP00000028814 NP_780654.1.92730 XP_006499202.1.92730 XP_006499203.1.92730 XP_006499204.1.92730 XP_006499205.1.92730 XP_006499206.1.92730 XP_006499207.1.92730 ENSMUSP00000028814 ENSMUSP00000099471 10090.ENSMUSP00000028814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]