SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029053 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029053
Domain Number 1 Region: 3-293
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029053   Gene: ENSMUSG00000027540   Transcript: ENSMUST00000029053
Sequence length 432
Comment pep:known chromosome:NCBIM37:2:167757827:167804885:1 gene:ENSMUSG00000027540 transcript:ENSMUST00000029053
Sequence
MEMEKEFEEIDKAGNWAAIYQDIRHEASDFPCKVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLK
CAQYWPQQEEKEMVFDDTGLKLTLISEDVKSYYTVRQLELENLTTKETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSLEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSREDLD
LPPEHVPPPPRPPKRTLEPHNGKCKELFSSHQWVSEETCGDEDSLAREEGRAQSSAMHSV
SSMSPDTEVRRRMVGGGLQSAQASVPTEEELSSTEEEHKAHWPSHWKPFLVNVCMATLLA
TGAYLCYRVCFH
Download sequence
Identical sequences P35821 Q3TZW9
ENSMUSP00000029053 10090.ENSMUSP00000029053 ENSMUSP00000029053 ENSMUSP00000029053 NP_035331.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]