SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029164 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029164
Domain Number 1 Region: 91-193
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-33
Family SH2 domain 0.0000425
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000276
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029164   Gene: ENSMUSG00000027636   Transcript: ENSMUST00000029164
Sequence length 259
Comment pep:known chromosome:NCBIM37:2:156698193:156712814:-1 gene:ENSMUSG00000027636 transcript:ENSMUST00000029164
Sequence
MGSLSSRGKTSSPSPSSSGPDQEPVSMQPERHKVTAVALGSFPAGEQARLSLRLGEPLTI
ISEDGDWWTVQSEVSGREYHMPSVYVAKVAHGWLYEGLSREKAEELLLLPGNPGGAFLIR
ESQTRRGCYSLSVRLSRPASWDRIRHYRIQRLDNGWLYISPRLTFPSLHALVEHYSELAD
GICCPLREPCVLQKLGPLPGKDTPPPVTVPTSSLNWKKLDRSLLFLEAPASGEASLLSEG
LRESLSSYISLAEDPLDDA
Download sequence
Identical sequences Q8R4L0
ENSMUSP00000029164 10090.ENSMUSP00000105189 ENSMUSP00000029164 NP_084259.1.92730 XP_006500468.1.92730 ENSMUSP00000029164 ENSMUSP00000105189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]