SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029374 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029374
Domain Number 1 Region: 2253-2553
Classification Level Classification E-value
Superfamily BEACH domain 2.62e-128
Family BEACH domain 0.0000000000139
Further Details:      
 
Domain Number 2 Region: 196-387
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-33
Family Clostridium neurotoxins, the second last domain 0.029
Further Details:      
 
Domain Number 3 Region: 2670-2923
Classification Level Classification E-value
Superfamily WD40 repeat-like 4e-30
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 4 Region: 2141-2248
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-29
Family PreBEACH PH-like domain 0.00000197
Further Details:      
 
Domain Number 5 Region: 479-586,665-961
Classification Level Classification E-value
Superfamily ARM repeat 2.45e-16
Family Plakophilin 1 helical region 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029374   Gene: ENSMUSG00000027799   Transcript: ENSMUST00000029374
Sequence length 2936
Comment pep:known chromosome:NCBIM37:3:55429127:55987623:-1 gene:ENSMUSG00000027799 transcript:ENSMUST00000029374
Sequence
MASDKPGPGLEPQPVALLAVGAGGGAGGGGAMGEPRGAAGSGPVVLPAGMINPSVPIRNI
RMKFAVLIGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDV
TCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVDMLGVLASYSI
TVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAK
WPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGK
GFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCF
LGSSETADANRVFCGQLGAVYVFSEALNPAQIFAVHQLGPGYKSTFKFKSESDIHLAEHH
KQVLYDGKLASSIAFSYNAKATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIH
SAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVAMQEQMLGGKG
FLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPA
KVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVINPADSSGIAPKGLDGP
RPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALM
SEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSL
FTLLGERLMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVAT
LLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKSSEEQ
KITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEE
ENIKKGKKGNVSTISGLSSQTAGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMS
TKVSDDILGSSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPETLVGGENGALV
EVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEELPNSSTPFLFDK
IPRQEEKLLPELSSNHIIPNIQDTQVHLGVSDDLGLLAHMTASVELTCTSSIMEEKDFRI
HTTSDGVSSVSERELASSTKGLDYAEMTATTLETESSNSKAVPNVDAGSIISDTERSDDG
KESGKEIRKIQTTATTQAVQGRSSTQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFR
IPEFKWSPMHQRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMV
DNIIIACGGILPLLSAATSPTGSKTELENIEVTQGMSAETAVTFLSRLMAMVDVLVFASS
LNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGSKSSHGSSKPQEAPHS
VTAASASKTPLENVPGNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYF
ISVLMVSKYRDILEPQRETARTGSQPGRNIRQEINSPTSTVVVIPSIPHPSLNHGLLAKL
MPEQSFAHSFYKETPATFPDTVKEKETPTPGEDIQLESSVPHTDSGMGEEQVASILDGAE
LEPAAGPDAMSELLSTLSSEVKKSQESLTEHPSEMLKPAPSISSISQTKGINVKEILKSL
VAAPVEIAECGPEPIPYPDPALKREAHAILPMQFHSFDRSVVVPVKKPPPGSLAVTTVGA
TAAGSGLPTGSTSSIFAAPGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQT
VAPMPEDSAENMSITAKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCM
KSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILN
RQRAEDVHKHAEFESQCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNK
HGAWGAVSHSQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKSAVEYGTEEDVVKS
KKAFRSQAIVNQNSETELMLEGDDDAVSLLQEKEIDNLAGPVVLSTPAQLIAPVVVAKGT
LSITTTEIYFEVDEDDAAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVF
MANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQ
RREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGAL
NPKRAVFYAERYETWEEDQSPPFHYNTHYSTATSALSWLVRIEPFTTFFLNANDGKFDHP
DRTFSSIARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYHLGVREDEVVVNDVDLPPW
AKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLD
SITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMV
LKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLP
IEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETG
KLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYP
APRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLIS
VSSEGHCIIYYERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQ
ACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences Q9EPN1
ENSMUSP00000029374 NP_085098.1.92730 10090.ENSMUSP00000029374 ENSMUSP00000029374 ENSMUSP00000029374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]