SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029433 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029433
Domain Number 1 Region: 18-312
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.71e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029433   Gene: ENSMUSG00000027843   Transcript: ENSMUST00000029433
Sequence length 802
Comment pep:known chromosome:NCBIM37:3:103664203:103716170:1 gene:ENSMUSG00000027843 transcript:ENSMUST00000029433
Sequence
MDQREILQQLLKEAQKKKLNSEEFASEFLKLKRQSTKYKADKIYPTTVAQRPKNIKKNRY
KDILPYDHSLVELSLLTSDEDSSYINASFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
RILVIVMACMEFEMGKKKCERYWAEPGETQLQFGPFSISCEAEKKKSDYKIRTLKAKFNN
ETRIIYQFHYKNWPDHDVPSSIDPILQLIWDMRCYQEDDCVPICIHCSAGCGRTGVICAV
DYTWMLLKDGIIPKNFSVFNLIQEMRTQRPSLVQTQEQYELVYSAVLELFKRHMDVISDN
HLGREIQAQCSIPEQSLTVEADSCPLDLPKNAMRDVKTTNQHSKQGAEAESTGGSSLGLR
TSTMNAEEELVLHSAKSSPSFNCLELNCGCNNKAVITRNGQARASPVVGEPLQKYQSLDF
GSMLFGSCPSALPINTADRYHNSKGPVKRTKSTPFELIQQRKTNDLAVGDGFSCLESQLH
EHYSLRELQVQRVAHVSSEELNYSLPGACDASCVPRHSPGALRVHLYTSLAEDPYFSSSP
PNSADSKMSFDLPEKQDGATSPGALLPASSTTSFFYSNPHDSLVMNTLTSFSPPLNQETA
VEAPSRRTDDEIPPPLPERTPESFIVVEEAGEPSPRVTESLPLVVTFGASPECSGTSEMK
SHDSVGFTPSKNVKLRSPKSDRHQDGSPPPPLPERTLESFFLADEDCIQAQAVQTSSTSY
PETTENSTSSKQTLRTPGKSFTRSKSLKIFRNMKKSVCNSSSPSKPTERVQPKNSSSFLN
FGFGNRFSKPKGPRNPPSAWNM
Download sequence
Identical sequences P29352
NP_033005.1.92730 XP_006501211.1.92730 XP_006501212.1.92730 XP_006501213.1.92730 XP_011238343.1.92730 XP_011238344.1.92730 ENSMUSP00000029433 ENSMUSP00000029433 ENSMUSP00000122307 10090.ENSMUSP00000029433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]