SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030556 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030556
Domain Number 1 Region: 10-293
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.97e-94
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030556   Gene: ENSMUSG00000028771   Transcript: ENSMUST00000030556
Sequence length 775
Comment pep:known chromosome:NCBIM37:5:20492463:20561729:-1 gene:ENSMUSG00000028771 transcript:ENSMUST00000030556
Sequence
MEQVEILRRFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVK
KNRYKDILPFDHSRVKLTLKTPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRM
IWEYNVVIIVMACREFEMGRKKCERYWPLYGEDPITFAPFKISCENEQARTDYFIRTLLL
EFQNESRRLYQFHYVNWPDHDVPSSFDSILDMISLMRKYQEHEDVPICIHCSAGCGRTGA
ICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQL
YEIHGAQKIADGNEITTGTMVSSIDSEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPHP
VPPILTPSPPSAFPTVTTVWQDSDRYHPKPVLHMASPEQHPADLNRSYDKSADPMGKSES
AIEHIDKKLERNLSFEIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASSSVVDRTSKPQEL
SAGALKVDDVSQNSCADCSAAHSHRAAESSEESQSNSHTPPRPDCLPLDKKGHVTWSLHG
PENATPVPDSPDGKSPDNHSQTLKTVSSTPNSTAEEEAHDLTEHHNSSPLLKAPLSFTNP
LHSDDSDSDGGSSDGAVTRNKTSISTASATVSPASSAESACTRRVLPMSIARQEVAGTPH
SGAEKDADVSEESPPPLPERTPESFVLADMPVRPEWHELPNQEWSEQRESEGLTTSGNEK
HDAGGIHTEASADSPPAFSDKKDQITKSPAEVTDIGFGNRCGKPKGPREPPSEWT
Download sequence
Identical sequences P35831
NP_035333.2.92730 ENSMUSP00000030556 ENSMUSP00000030556 NYSGXRC-8609b 10090.ENSMUSP00000030556 ENSMUSP00000030556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]