SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030645 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030645
Domain Number 1 Region: 320-486
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-36
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000393
Family SAM (sterile alpha motif) domain 0.0000402
Further Details:      
 
Domain Number 3 Region: 176-274
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000306
Family PDZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030645   Gene: ENSMUSG00000028841   Transcript: ENSMUST00000030645
Sequence length 700
Comment pep:known chromosome:NCBIM37:4:133783956:133794314:-1 gene:ENSMUSG00000028841 transcript:ENSMUST00000030645
Sequence
MEPVEAWTPGKVAAWLRGLDDALQDYPFEDWQLPGKYLLQLCPQSLEALTVWPLGHQELI
LDGVEQLRALGSNLQTENLQSLAQGLLERTQAFQSLVQGSLGNCAETPADVLKAAVELVR
EAHALLSWLNGYLFSHLNDFSACQEIGVLCGELGQVLQEDCPEAEKERNILRICSHVAGI
CHNILSCSPEELLEQKAVLESVQVDDPSGLEIHTTSNCLHFVSRVGVQAATSSQILPGDE
IVQVNEQVVVGWSHKNMLRELLREPAKVSLVLKKIPVPETPSQTSLDSPHLLSQSLPLNP
PSPRVPSEGLLADGTPGPSPAWTDSTSFDAQSPPTPPGPPGVLPEETAEPLESSGHPDKS
PILGRKKSKGIATRLSRRRVSCRELGLPDCDGWLLLRKVPGGFMGPRWRRCWFVLKGHTL
YWYRQPQDEKAEGLINLSNYSLESGHDQKKKYVFQLTHDVYKPFIFAAETLSDLSKWVRH
LITCISKYQAQGRAPSSAREEDCYSETEAEDPDEEAGSRSASPGPAQAWSDTSPVASPLQ
SPRTSFNSSPDSSDRALEGMVQGLRQGGVSLLGQPQPLTHEQWRSSFMRRNRDPHLNERA
HRIRALQSTLKAKLQELQALEEVLGDPELTSAKFRQWKEQNQELYSEGLRTWGGTWAQTS
SSDPNSDSRAHSPQPLPFDPEEPSQLFPLTPENSRQPPDL
Download sequence
Identical sequences A2A9K7
ENSMUSP00000030645 ENSMUSP00000030645 ENSMUSP00000030645 NP_001074516.1.92730 10090.ENSMUSP00000030645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]