SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031171 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031171
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-32
Family Pleckstrin-homology domain (PH domain) 0.000000567
Further Details:      
 
Domain Number 2 Region: 172-265
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000438
Family SH2 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031171   Gene: ENSMUSG00000029254   Transcript: ENSMUST00000031171
Sequence length 297
Comment pep:known chromosome:NCBIM37:5:86500771:86533018:1 gene:ENSMUSG00000029254 transcript:ENSMUST00000031171
Sequence
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLVKRSDHQEYKHYWTELRGTTLFFYTDK
KSTIYVGKLDIIDLVCLTGQHSTEKNCAKFTLVLPKEEVHVKTENTESGEEWRGFILTVT
ELTVPQHVSLLPGQVIRLHEVLEREKKRRIETDQLPLMPPEKEKEPVQDYADVLNPLPEC
FYAVSRKEATAMLEKNPSWGNMILRPGSDSKNYSITIRQEIEMPRIKHFKVTRTGNNYTI
ELEKPVTLPNLFSVIDYFVKETRGNLRPFIHSADDNFGQDPNIEDRSEKFKKNPHNA
Download sequence
Identical sequences Q9JM90
10090.ENSMUSP00000031171 ENSMUSP00000031171 NP_064376.1.92730 ENSMUSP00000031171 ENSMUSP00000031171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]