SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031542 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031542
Domain Number 1 Region: 6-204
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.35e-54
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.0000294
Further Details:      
 
Domain Number 2 Region: 205-347
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.92e-53
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000351
Further Details:      
 
Domain Number 3 Region: 404-504
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.58e-21
Family Ubiquitin-related 0.007
Further Details:      
 
Domain Number 4 Region: 347-432
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000243
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031542   Gene: ENSMUSG00000029561   Transcript: ENSMUST00000031542
Sequence length 508
Comment pep:known chromosome:NCBIM37:5:115346945:115362243:1 gene:ENSMUSG00000029561 transcript:ENSMUST00000031542
Sequence
MDPFPDLYATPGDSLDHFLEHSLQPQRDWKEEGQDAWERIERFFREQCFRDELLLDQEVR
VIKVVKGGSSGKGTTLNHRSDQDMILFLSCFSSFEEQARNREVVISFIKKRLIHCSRSLA
YNIIVLTHREGKRAPRSLTLKVQSRKTDDIIWMDILPAYDALGPISRDSKPAPAIYETLI
RSKGYPGDFSPSFTELQRHFVKTRPVKLKNLLRLVKFWYLQCLRRKYGRGAVLPSKYALE
LLTIYAWEMGTESSDSFNLDEGFVAVMELLVNYRDICIYWTKYYNFQNEVVRNFLKKQLK
GDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTTVGPSERWNVQRARDVQVRVK
QTGTVDWTLWTNPYSPIRKMKAEIRREKNFGGELRISFQEPGGERQLLSSRKTLADYGIF
SKVNIQVLETFPPEILVFVKYPGGQSKPFTIDPDDTILDLKEKIEDAGGPCAEDQVLLLD
DEELEDDESLKELEIKDCDTIILIRVID
Download sequence
Identical sequences Q9Z2F2
NP_035984.2.92730 XP_006530377.1.92730 XP_006530378.1.92730 10090.ENSMUSP00000031542 ENSMUSP00000031542 ENSMUSP00000031542 ENSMUSP00000031542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]