SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031651 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031651
Domain Number 1 Region: 445-683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000906
Family Protein kinases, catalytic subunit 0.0097
Further Details:      
 
Domain Number 2 Region: 50-77
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000235
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031651   Gene: ENSMUSG00000029647   Transcript: ENSMUST00000031651
Sequence length 837
Comment pep:known chromosome:NCBIM37:5:148242156:148360077:1 gene:ENSMUSG00000029647 transcript:ENSMUST00000031651
Sequence
MNSGGGGGLPPPSAAASPSSSSLAAAVAVAVAASSGVGGVPGGPAAAAGVKLKYCRYYAK
DKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAAAAGAAFPPGALPGGGAGPPAGP
KKPELGVPGAATAGGGLDGPRVAIPGMDGGALTDASLTESYFSTSFIGVNGFGSPVETKY
PLMQRMTSSSSSPSLLNDSAKPYTGHDLLTSSASSLFNDFGALNISQRRKTPNPTASEFI
PKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTS
PAPRRRSHTPNPASFMVPPSASTPANNPAPQPPSSGQVIQKETVGGTTYFYTDTTPAPLT
GMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPT
EVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCM
VLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNSDAYFTK
RKWGQHDGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITSKTRL
RVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAM
ELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKE
VQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSH
IISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGNDRNSN
Download sequence
Identical sequences Q640Q5
ENSMUSP00000031651 NP_082567.3.92730 ENSMUSP00000031651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]