SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032071 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032071
Domain Number 1 Region: 30-214
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-54
Family Dual specificity phosphatase-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032071   Gene: ENSMUSG00000030002   Transcript: ENSMUST00000032071
Sequence length 321
Comment pep:known chromosome:NCBIM37:6:85892262:85911661:-1 gene:ENSMUSG00000030002 transcript:ENSMUST00000032071
Sequence
MNQHYGRHGRGRGRDFAACAPPKKKGRNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKKF
EAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYKVEDLPETISYIKIFTVGHQI
PDNDTIFQFKCAVKEFLKKNKNNDKLIGVHCTHGLNRTGYLICRYLIDVEGMRPDDAIEL
FNSCRGHCIERQNYIENLQKRHVRKNRNVSAPRTDGLEDSADPTEQVYTNNKPVKKKPRK
NRRGGHLAPSQHFQHQTQSSPYSLRKWSQNQSVYQRGLVPPPGPAGEDYSQRRFFWSARP
NKWTAESYQRPFYPYYWEWNL
Download sequence
Identical sequences Q6NXK5
ENSMUSP00000032071 ENSMUSP00000032071 NP_082375.4.92730 ENSMUSP00000032071 10090.ENSMUSP00000032071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]