SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032663 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032663
Domain Number 1 Region: 31-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000102
Family V set domains (antibody variable domain-like) 0.012
Further Details:      
 
Domain Number 2 Region: 244-317
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000011
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000032663
Domain Number - Region: 166-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000388
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032663   Gene: ENSMUSG00000030472   Transcript: ENSMUST00000032663
Sequence length 376
Comment pep:known chromosome:NCBIM37:7:50890109:50904657:1 gene:ENSMUSG00000030472 transcript:ENSMUST00000032663
Sequence
MDFSRPSFSPWRWLTLVASLLTCGICQASGQIFISPDSLLGVEKYRTILTLENVPEDVLE
YSWYRGKDNSTENMIFSYKPPNTRHPGPSYSGRENVTRAGSLVVRMSAVNDTGYYTVEVD
TSNETQRATGWLQIVKLRSNPGISANTSALVEGMDSVVAKCLTNSSNISWYVNFVPTSGS
NRMTISPDGKTLIIHRVSRYDHTLQCAIEDVPEILQKSELIQLTVAYGPDYVSLWTQPYF
FAGVLTADIGSSVQLECNCFSKPEPRYHWIHNGSFLSIPENNMTLPSLSWEQMGSYRCVV
ENPETQLTFYRDVTIQPPRPPLPTVNRELYIPGPLVIFLILLTSLGGAFVCRVLVYSLFQ
SCSRGKTCHKCPWQTN
Download sequence
Identical sequences Q9D871
NYSGRC-IgSF-Q9D871 ENSMUSP00000032663 10090.ENSMUSP00000032663 NP_082512.1.92730 ENSMUSP00000032663 ENSMUSP00000032663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]