SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033006 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033006
Domain Number 1 Region: 201-233
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000126
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000033006
Domain Number - Region: 20-116
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0259
Family L-aspartase/fumarase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033006   Gene: ENSMUSG00000030750   Transcript: ENSMUST00000033006
Sequence length 280
Comment pep:known chromosome:NCBIM37:7:132611154:132635110:-1 gene:ENSMUSG00000030750 transcript:ENSMUST00000033006
Sequence
MASGVISLVCAPSNMQGSTRRAGAMTDVHRRFLQLLMTHGVLEEWEVRRLQNHCYQVHDR
NATVDKLEDFINNINSVLESLYIEIKKGVTEDDGRPIYALVNLATTSVSKMATDFAENEL
DLFRKALELIVDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQSKWLIEKEGEF
TLHGRAILEMEQFIRESYPDSVKMCNICHGLLIQGQSCETCGIRMHLPCVAKYFQSIPEP
HCPHCNDYWPHDIPEVYNPEKEREAGISKSSRKSLRTRQH
Download sequence
Identical sequences A0A0R4J0C0
ENSMUSP00000033006 10090.ENSMUSP00000033006 ENSMUSP00000033006 ENSMUSP00000033006 NP_080606.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]