SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033133 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033133
Domain Number 1 Region: 24-165
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.15e-41
Family Regulator of G-protein signaling, RGS 0.000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033133   Gene: ENSMUSG00000030844   Transcript: ENSMUST00000033133
Sequence length 181
Comment pep:known chromosome:NCBIM37:7:135517135:135561687:-1 gene:ENSMUSG00000030844 transcript:ENSMUST00000033133
Sequence
MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPEGVQRFREFLK
KEFSEENVLFWLACEDFKKTEDRKQMQEKAKEIYMTFLSNKASSQVNVEGQSRLTEKILE
EPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKPKRTEEEEEEPPDAQTAAKRASRIYN
T
Download sequence
Identical sequences Q32MD7 Q9CQE5
NP_080694.1.92730 ENSMUSP00000033133 ENSMUSP00000033133 ENSMUSP00000033133 10090.ENSMUSP00000033133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]