SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033201 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033201
Domain Number 1 Region: 6-118
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-27
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 350-409
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000436
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033201   Gene: ENSMUSG00000030909   Transcript: ENSMUST00000033201
Sequence length 423
Comment pep:known chromosome:NCBIM37:7:127317372:127327230:1 gene:ENSMUSG00000030909 transcript:ENSMUST00000033201
Sequence
MSTRYHQAASDSYLELLKEATKRDLNLSDEDGMTPTLLAAYHGNLEALEIICSRGGDPDK
CDIWGNTPLHYAASNGHTHCISFLVNFGANIFALDNDLKSPLDAAASREQKECVALLDKA
ATVQNTMNPKRVTRLKEQALKNARKQMKECERLQERHQNKMARTYSKEDSGTISSSHSTL
SRSFLSTTSAGRFGSLSKGIKDTFKIKSKKNKDTTEQLEKDGRSGQRPVMEVFREEEEDS
FPKDFKEKLHFSVEEDDDVQHESILNRPGLGSIVFSRNRVLDFEDISDSKRELGFKMPSE
LFQRQGAAGTVEEEEEEEEEEEEEKREANGTAGDLPWDEEEVEWEEDAVDATPLEVFLQS
QHLEEFLPIFMREQIDLEALLLCSDEDLQNIHMQLGPRKKVLSAIDKRKQVLQQPGQLVD
TSL
Download sequence
Identical sequences Q8K3X6
NP_082361.2.92730 ENSMUSP00000033201 ENSMUSP00000033201 ENSMUSP00000033201 10090.ENSMUSP00000033201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]