SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033427 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033427
Domain Number 1 Region: 247-317
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.73e-17
Family SAM (sterile alpha motif) domain 0.00024
Further Details:      
 
Domain Number 2 Region: 167-268
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000486
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033427   Gene: ENSMUSG00000031101   Transcript: ENSMUST00000033427
Sequence length 380
Comment pep:known chromosome:NCBIM37:X:45499613:45514742:1 gene:ENSMUSG00000031101 transcript:ENSMUST00000033427
Sequence
MLRRKPSNASDKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVL
TPEDSGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMGDTLEEGSASPTSPDCSLDS
PGPEKMALAFTEQEEREPPSLSRQTSTGSELCSPGPGSGSFLEESPAPQYTGPFCGRARV
HTDFTPSPYDHDSLKLQKGDVIQIVEKPPVGTWLGLLNGKLGSFKFIYVDVLPEEAVGPV
RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDP
QHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRD
EAELAGTEEQLQGLSLSGAP
Download sequence
Identical sequences Q8K352
10090.ENSMUSP00000033427 ENSMUSP00000033427 ENSMUSP00000033427 ENSMUSP00000033427 NP_083049.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]