SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033827 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033827
Domain Number 1 Region: 190-525
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-81
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 38-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.39e-39
Family Regulator of G-protein signaling, RGS 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033827   Gene: ENSMUSG00000031450   Transcript: ENSMUST00000033827
Sequence length 564
Comment pep:known chromosome:NCBIM37:8:13405081:13421945:1 gene:ENSMUSG00000031450 transcript:ENSMUST00000033827
Sequence
MDFGSLETVVANSAFIAARGSFDGSSTPSSRDKKYLAKLRLPPLSKCEGLRDNLSLEFES
LCSEQPIGKRLFQQFLKTDERHVPALELWKDIEDYDTADDDLRPQKAQAILAEYLDPQGT
LFCNFLDQGMVTRVKEGPTGSQDGLFQPLLQATMEHLSQAPFQEYLESLYFLRFLQWKWL
EAQPIGEDWFLDFRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYQGAIVEKR
ILTKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDVRYHIYNVDEDNPGFSEPRAIYYTAQ
IISGLEHLHQRRIVYRDLKPENVLLDNDGNIRISDLGLAVELKEGQNKTKGYAGTPGFMA
PELLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRIISEPVKYPEKFS
QASKDFCEQLLEKDPEKRLGFRDGTCDALRANVLFKDISWRQLEAGMLIPPFIPDSRTVY
AKNIQDVGAFSTVKGVVFDKADTEFFQEFASGNCSIPWQEEMIETGLFGDLNVWRADGQM
PDDMKGITTEEAAPTAKSGMCLIS
Download sequence
Identical sequences G3X905
ENSMUSP00000033827 10090.ENSMUSP00000033827 ENSMUSP00000033827 NP_036011.3.92730 ENSMUSP00000033827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]