SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033917 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000033917
Domain Number - Region: 54-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0211
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033917   Gene: ENSMUSG00000031518   Transcript: ENSMUST00000033917
Sequence length 295
Comment pep:known chromosome:NCBIM37:8:55686134:55695451:1 gene:ENSMUSG00000031518 transcript:ENSMUST00000033917
Sequence
MAAAGQAEECLPLPAAESSKTSLPTPPAVPAGKKPKKCLVYPHPPRSSRLSRSVLRWLQG
LDLSFFPRNVTRDFSNGYLVAEIFCIYYPWDLRLSSFENGTSLKVKLDNWAQIEKFLAKK
KFKLPKELIHGTIHCKAGVPEILIQEIYTLLTHQEIRSIQDDLANFTDYIYQMRLPLVPR
NTVSKSIKNNIRLSELLSNPNVLSNELKIEFLILLQMLQRKLSRKLNPGWFDVKPTVGEI
TIDRLPAHSYKRRYKSRGSKEKAAQPLSKSDNDGNARKEIHVKQSGNPCENTENL
Download sequence
Identical sequences Q8K3V1
ENSMUSP00000033917 10090.ENSMUSP00000033917 ENSMUSP00000033917 ENSMUSP00000033917 NP_598472.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]