SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033930 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033930
Domain Number 1 Region: 188-339
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.67e-45
Family Dual specificity phosphatase-like 0.00000344
Further Details:      
 
Domain Number 2 Region: 3-164
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.03e-24
Family Cell cycle control phosphatase, catalytic domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033930   Gene: ENSMUSG00000031530   Transcript: ENSMUST00000033930
Sequence length 398
Comment pep:known chromosome:NCBIM37:8:35870351:35882948:1 gene:ENSMUSG00000031530 transcript:ENSMUST00000033930
Sequence
MVTMEELREMDCSVLKRLMNRDENGGGGSAGGNGSGSHGALGLLSGGKCLLLDCRPFLAH
SAGYIRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAE
SLREDSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSTN
ESLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHF
EGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLM
MKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLTTSCAAEAASPSGPLRERGKA
TPTPTSQFVFSFPVSVGVHAAPSNLPYLHSPITTSPSC
Download sequence
Identical sequences Q8BFV3
NYSGXRC-8689b ENSMUSP00000033930 NP_795907.1.92730 10090.ENSMUSP00000033930 ENSMUSP00000033930 ENSMUSP00000033930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]