SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034087 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034087
Domain Number 1 Region: 56-186
Classification Level Classification E-value
Superfamily PX domain 5.1e-25
Family PX domain 0.0039
Further Details:      
 
Domain Number 2 Region: 189-284
Classification Level Classification E-value
Superfamily TPR-like 0.00005
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034087   Gene: ENSMUSG00000031662   Transcript: ENSMUST00000034087
Sequence length 313
Comment pep:known chromosome:NCBIM37:8:91150727:91160027:-1 gene:ENSMUSG00000031662 transcript:ENSMUST00000034087
Sequence
MASPEHPGSPGWRGPINQCRTRTRQEVLPPGPDLPCPGPEEAQDGPSSNSSMTTRELQEH
WQKEKSRWKHVRLLFEIASARIEERKVSKFVMYQVVVIQTGSFDSDKAVVERRYSDFERL
QKALLKRFGPELEDVAFPRKRLTGNLSAETICERRRELREYLRLLYAVRAVRRSREFLDF
LTRPELREAFGCLRAGQYARALELLGRALPLQEKLTAHCPSAAVPALCAALVCLRDLERP
AEAFAVGERALRCLRTRENHRYYAPLLDAMVRLAYALGKDFAALQSRLDENQLRRPTHRD
ATLKELTVREYLS
Download sequence
Identical sequences A0A0R4J0D0
10090.ENSMUSP00000034087 ENSMUSP00000034087 ENSMUSP00000034087 NP_082116.1.92730 XP_006531434.1.92730 ENSMUSP00000034087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]