SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034270 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034270
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.84e-73
Family GABARAP-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034270   Gene: ENSMUSG00000031812   Transcript: ENSMUST00000034270
Sequence length 125
Comment pep:known chromosome:NCBIM37:8:124114368:124121947:1 gene:ENSMUSG00000031812 transcript:ENSMUST00000034270
Sequence
MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG
TAMAV
Download sequence
Identical sequences Q9CQV6
NP_080436.1.92730 ENSMUSP00000034270 ENSMUSP00000034270 10090.ENSMUSP00000034270 ENSMUSP00000034270 5wrd_A 5wrd_B 5yiq_A 5yis_A 5yis_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]