SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034534 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034534
Domain Number 1 Region: 303-435
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-50
Family ets domain 0.000000198
Further Details:      
 
Domain Number 2 Region: 30-135
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.57e-35
Family Pointed domain 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034534   Gene: ENSMUSG00000032035   Transcript: ENSMUST00000034534
Sequence length 440
Comment pep:known chromosome:NCBIM37:9:32503627:32565405:1 gene:ENSMUSG00000032035 transcript:ENSMUST00000034534
Sequence
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGR
ASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDAD
Download sequence
Identical sequences P27577 Q540Q5
10090.ENSMUSP00000034534 ENSMUSP00000034534 NP_035938.2.92730 ENSMUSP00000051303 ENSMUSP00000034534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]