SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034832 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034832
Domain Number 1 Region: 293-576
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.44e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000268
Further Details:      
 
Domain Number 2 Region: 87-262
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-35
Family CRAL/TRIO domain 0.0004
Further Details:      
 
Domain Number 3 Region: 3-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000000353
Family CRAL/TRIO N-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034832   Gene: ENSMUSG00000032290   Transcript: ENSMUST00000034832
Sequence length 593
Comment pep:known chromosome:NCBIM37:9:56842775:56910612:1 gene:ENSMUSG00000032290 transcript:ENSMUST00000034832
Sequence
MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLR
AVELFHCYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPH
KSAQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFP
ARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECLPENLGGYVK
IDLATWNFQFLPQVNGHPDPFDEIILSSLPPALDWDSVHVPGPHAMTIQELVDYVNTRQK
RGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINA
SFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEK
DSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASL
IDFLRVVRNQQSMAVGNLGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGT
LNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEREGMVPSGHSLLAMDGQ
Download sequence
Identical sequences O35239 Q2M4G8
NYSGXRC-13126a NYSGXRC-8607b ENSMUSP00000034832 10090.ENSMUSP00000034832 ENSMUSP00000034832 ENSMUSP00000034832 NP_062625.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]