SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034896 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034896
Domain Number 1 Region: 35-95,126-299
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034896   Gene: ENSMUSG00000032342   Transcript: ENSMUST00000034896
Sequence length 669
Comment pep:known chromosome:NCBIM37:9:78296015:78321959:1 gene:ENSMUSG00000032342 transcript:ENSMUST00000034896
Sequence
MFLLRGRGHWAAASLGRRLPLRRLRSDSAAPCTPHFDVVVIGGGHAGTEAAAAAARCGSR
TLLLTHRVDTIGQMSCNPSFGGIGKGHLMREVDALDGLCSRICDQSGIHYKVLNRRKGPA
VWGLRAQIDRKLYKQNMQKEILSTPLLTVQKGAVEDLVLAEPEPGYPGKSRVRGVVLADG
STIYAESVILTTGTFLRGMIIIGLEMHPAGRLGDQPSIGLAQTLEKLGFMVGRLKTGTPP
RLAKESINFSILNKHTPDDPSIPFSFLSDSVWIKPEDQLPCYLTHTNPRVDAIVLENLHL
NSHVQETTKGPRYCPSIESKVLRFPNRLHQVWLEPEGMDSDLIYPQGLSVTLPAELQEKM
ITCIRGLEKAKMVHPGYGVQYDYLDPRQISPSLETHLVQRLFFAGQINGTTGYEEAAAQG
VIAGINASLRVSRKPPFVVSRTEGYIGVLIDDLTTLGTSEPYRMFTSRVEFRLSLRPDNA
DTRLTFRAHKEAGCVSSQRFERALWMKSSLEEGISVLKSIKFSSSKWKKLIPQIPISINR
SLPVSALDVLKYEEVDMESLVGVLPEPLEKYTACRELARRLKIEASYESVLSYQLQEIKE
VQQDEALQLPHELDYLTIRDVSLSQEVREKLHLSRPQTIGAASRIPGVTPAAIINLLRFV
RSTRQSRQQ
Download sequence
Identical sequences G5E889
NP_080934.2.92730 10090.ENSMUSP00000034896 ENSMUSP00000034896 ENSMUSP00000034896 ENSMUSP00000034896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]