SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035083 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035083
Domain Number 1 Region: 284-345
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-21
Family SH3-domain 0.0006
Further Details:      
 
Domain Number 2 Region: 107-161
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000035083
Domain Number - Region: 347-399
Classification Level Classification E-value
Superfamily SH3-domain 0.00134
Family SH3-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035083   Gene: ENSMUSG00000032502   Transcript: ENSMUST00000035083
Sequence length 403
Comment pep:known chromosome:NCBIM37:9:111463941:111592852:-1 gene:ENSMUSG00000032502 transcript:ENSMUST00000035083
Sequence
MIPPSGAREDSGDGLTGEATGTEQPPSPASTSSLESKLQKLKRSLSFKTKSLRSKSADNF
FPRTNSDVKPQADLLAKASPGPSPIAIPGSPASMPTKAGLHPGSNSKLHAFQEHVFKKPT
FCDVCNHMIVGTHAKHGLRCGACKMSIHHKCADGLAPQRCMGKLPKGFRRYYSSPLLIHE
QFGCIKEVMPIACGNKVDPVYEALRFGTSLAQRTKKGGSGSGSDSPPRTSTSELVDVPEE
ADGPGDGSDMRTRSNSVFTYPENGMDDFRDQMKTTNHQGPLSKDPLQMNTYVALYRFIPQ
ENEDLEMRPGDMITLLEDSNEDWWKGKIQDRVGFFPANFVQRVEEHEKIYRCVRTFIGCK
DQGQITLKENQICVTSEEEQDGFIRVLSGKKRGLVPLDVLVDV
Download sequence
Identical sequences P97306 Q3UPL9
ENSMUSP00000035083 10090.ENSMUSP00000035083 NP_058549.1.92730 ENSMUSP00000035083 ENSMUSP00000035083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]