SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035528 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035528
Domain Number 1 Region: 918-1225
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000109
Further Details:      
 
Domain Number 2 Region: 1185-1484
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.9e-83
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000008
Further Details:      
 
Domain Number 3 Region: 22-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-43
Family MAM domain 0.0000000248
Further Details:      
 
Domain Number 4 Region: 383-577
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-28
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 5 Region: 281-414
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000312
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 6 Region: 190-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000178
Family I set domains 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035528   Gene: ENSMUSG00000033278   Transcript: ENSMUST00000035874
Sequence length 1486
Comment pep:known chromosome:NCBIM37:17:67016290:67703413:-1 gene:ENSMUSG00000033278 transcript:ENSMUST00000035874
Sequence
MRTLGTCLVTLAGLLLTAAGETFSGGCLFDEPYSTCGYSQADEDDFNWEQVNTLTKPTSD
PWMPSGSFMLVNTSGKPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNAAPGLLNVYVKV
NNGPLGNPIWNISGDPTRTWHRAELAISTFWPNFYQVIFEVVTSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMICTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYG
YQVGGQEQVREEVSWDTDNSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELTVQTDED
LPGAVPTESIQGSAFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYEFETPLNQT
DNTVTVMLKPAQSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASILNSQYY
FAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPHKSYRIYYQAASRANGETKIDCVRVA
TKAAIIVTQLTTPYIRIAPAAGDGQLTGAVTPKPVPEPEKQTDHTVKIAGVIAGILLFVI
IFLGVVLVMKKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMGTHNLN
GRSVSSPSSFTMKTNTLSTSVPNSYYPDPFVPTAILDETHTMASDTSSLAQPHTYKKREA
ADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEGQSAPWDSAKKDENRMK
NRYGNIIAYDHSRVRLQMLEGDNNSDYINGNYIDGYHRPNHYIATQGPMQETIYDFWRMV
WHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIKVTLIDTELLAEYVIRTFAVEKRG
IHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPNAGPLVVHCSAGAGRTGCFI
VIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSIPASQ
VRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPD
RCLPFLITIDGESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVML
NDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEEDIISRIFRIYNASRPQDGHRMVQQF
QFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGGGRSGTFCAISIVC
EMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLNSG
Download sequence
Identical sequences Q68FM4
ENSMUSP00000035528 XP_006523933.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]