SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035610 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035610
Domain Number 1 Region: 646-697
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000023
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000035610
Domain Number - Region: 325-369
Classification Level Classification E-value
Superfamily WWE domain 0.00824
Family WWE domain 0.01
Further Details:      
 
Domain Number - Region: 442-475,534-591
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0899
Family Fungal lipases 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035610   Gene: ENSMUSG00000055319   Transcript: ENSMUST00000042942
Sequence length 998
Comment pep:known chromosome:NCBIM37:7:135888384:135928350:1 gene:ENSMUSG00000055319 transcript:ENSMUST00000042942
Sequence
MADRKANGGGASASSSGTNLLFSSSATEFSFNVPFIPVTQAAASPASLLLPGEDSTDVGE
EDSFLGQTSTHTSTPQTFSYFSQVSSSSDPFGNIGQSPLTTSAMSAGQSALPKPPATLAF
TTGSQDALSAFPPSVSKAPGATPPSQMGTSTYLPSQPSSLPPNFGSPPQGIPQQGHNPYR
HTPVSSRANPYITPPQLQQCQMPGHSSYPPPSGPPVQTYQMPPGPLPPLPTAMQSPAQQQ
VPARPAGPLVQGPSPFVLQNQYEPVQPHWFYCKEVEYKQLWMPFSVLDSLNLEEIYNSVQ
PDPESVVLGTDGGRYDVYLYDRMRKSVYWEEEPTEVRRCTWFYKGDTDSRFIPYTEEFSE
KLEAEYKKAVSTNQWHRRLEFPSGETIVMHNPKVIVQFQPSSVPDEWGTTQDGQTRPRVV
KRGIDDSLDEIPDGEMPQVDHLVFMVHGIGPVCDLRFRSIIECVDDFRVVSLKLLQTHFK
KSVDEGKVSRVEFLPVHWHSALGGHATGVDRNIKKITLPSIGRFRHFTNETLLDVLFYNS
PTYCQAIVEKVEVEINRLHSLFMSRNPNFKGKVSVAGHSLGSLILFDILSNQRDMCVSKS
PGSVAVSNGVIKHSQFQEKLISEESKLMSDESCDLDVEDEEPLTLHGTLEALSLFDYIST
FEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVKLKAAKLEQKKAAAEKKAALAALT
KGQDESAPKTKEMASPSSESNESKRKLSVGAYVSSVRVDYESFEVGTGQVSVAYSSLDFE
PEIFFALGSPIGMLLTIRGVARIDEKYRLPTCKGFFNIYHPLDPVAYRLEPMIAPDLDLK
AVLVPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSTTQLQEEL
EKVANQIKEEEEKQVVEAEKIVESPELSKDEDYLGKVGMLNGGRRIDYVLQEKPIESFNE
YLFALQSHLCYWGSEDTALLLLKEIYRTMNISPEQPQH
Download sequence
Identical sequences G3X928
NP_001025153.2.92730 ENSMUSP00000035610 ENSMUSP00000035610 ENSMUSP00000035610 10090.ENSMUSP00000035610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]