SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035662 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035662
Domain Number 1 Region: 911-1086
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 485-601
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.4e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.002
Further Details:      
 
Domain Number 3 Region: 240-375
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-25
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 4 Region: 1170-1317
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000575
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Domain Number 5 Region: 598-779
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000603
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 6 Region: 8-63
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000295
Family SAM (sterile alpha motif) domain 0.0058
Further Details:      
 
Domain Number 7 Region: 385-492
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000218
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 8 Region: 794-902
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000448
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 9 Region: 1127-1190
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000878
Family Ras-binding domain, RBD 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035662   Gene: ENSMUSG00000024451   Transcript: ENSMUST00000042944
Sequence length 1538
Comment pep:known chromosome:NCBIM37:18:38132278:38157228:-1 gene:ENSMUSG00000024451 transcript:ENSMUST00000042944
Sequence
MAAPQDLDIAVWLALVHLEQYADTFRRHGLATAGAAQHLGHEELRHLGISATGHRKRILR
LLRAGSAEGFLDSHLDNTMEPTPSPAPDAQPPKPVPKPRTVFGLSNPATAQRPGLSPIFW
DPEVSRNSECTQRSSPLLPSSSEQPSVPNTMEMMPNAIYFGLDLRGRAQAAQDVTPDSSQ
ATVPTPAFRPTTGTVHIMDPGCLYYGVQPVGIPGASDRRDGRGVCQERAEHRQDLETRED
AGYASLELPGDSILSLPTQDAETSDDLISPYASFSSTADRPVPLLSGWLDKLSPQGNYVF
QRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFRTESEA
QRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLELRGHKAKVFAALIPGELALYKSE
QAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQEAVTET
LSDYEVAEKVWSNPANRHCADCRASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLK
LDTSVWSNEIVQLFIVLGNDRANCFWAGALPPGEGLHPDSAPGPRGEFISRKYKLGLFRK
PHPRHPDHSQLLQALCAAMAGPNLLKNMAQLLCVETSEGEEPLSPSALNGSLLSLLPSDS
PGVYNEVVVPATYRGFLYCGSISNKAGAPPLRRGRDAPPRLWCVLGAALEMFASESSPEP
LSLLQPQDIVCLGVSPPPADPGDLDRFPFSFELILTGGRIQHFATDGADSLEAWISAVGK
WFSPLSCHQLLGPGLLRMGRLWLRSPSHAGLAPGLWLSGFGLLRGDHLFLCPAPGPGPPA
PEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFAAWNTAIGGAAGG
GGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSV
KLRPREHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELSQKNQRLEKYKEVISCLP
RVNRRTLATLIGHLYRVQKCASLNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQELIDGY
ISVFDIDSDQAAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSPTLTA
EELTNQVLEMRGAASGTDLWVTFEILEHGELERPLHPKEKVLEQALQWCQLPEPCSASLL
LRKVSMAHAGCLFTGVRRESPRVGLLRCREEPPRLLGNRFQERFFLVRGRCLLLLKEKKS
SKPEREWSLEGAKVYLGIRKKLKPPTLWGFTLILEKMHLCLSCMDEEEMWDWTTSILKAQ
HDDQQSVVLRRRSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFP
MKSPQGSVEEQDELEEPVYEEPVYEEVGAFPELTKDTTFSSTWEWSAKSDPSLTSQRSFD
QPPLSKASMLGHEERIPDPPPGPPSKSSSQARGSLEEQLLQELNNLILRKGEPASCPESS
SQPTSPQAPSPTSLPTPTPSLPTQPPCTSNPPSSQPLT
Download sequence
Identical sequences Q8R5G7
NP_631945.2.92730 XP_006525552.1.92730 ENSMUSP00000035662 10090.ENSMUSP00000035662 ENSMUSP00000035662 ENSMUSP00000035662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]