SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035908 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035908
Domain Number 1 Region: 274-468
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000475
Further Details:      
 
Domain Number 2 Region: 24-159
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-27
Family SH2 domain 0.0000000899
Further Details:      
 
Domain Number 3 Region: 204-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.22e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035908   Gene: ENSMUSG00000004633   Transcript: ENSMUST00000046856
Sequence length 468
Comment pep:novel chromosome:NCBIM37:6:53989567:54250715:1 gene:ENSMUSG00000004633 transcript:ENSMUST00000046856
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRF
ESIHDLVTDGLITLYIETKAAEYIAKMTTNPIYEHIGYATLLREKVSRRLSRSKNESRKA
SVSNEEHTPVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLP
IPIITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN
LMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences Q3V2R3
10090.ENSMUSP00000035908 ENSMUSP00000035908 NP_001157112.1.92730 ENSMUSP00000035908 ENSMUSP00000035908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]