SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036053 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036053
Domain Number 1 Region: 216-279
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 546-612,652-737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000396
Family SPRY domain 0.024
Further Details:      
 
Domain Number 3 Region: 423-529
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000423
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 25-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000278
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000036053
Domain Number - Region: 167-202
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0345
Family TFIIH p44 subunit cysteine-rich domain 0.077
Further Details:      
 
Domain Number - Region: 265-341
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0497
Family Apolipoprotein A-I 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036053   Gene: ENSMUSG00000042766   Transcript: ENSMUST00000041022
Sequence length 759
Comment pep:known chromosome:NCBIM37:3:89038099:89049819:-1 gene:ENSMUSG00000042766 transcript:ENSMUST00000041022
Sequence
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
LHPQTILFPCPACQGDVELGERGLSGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
EATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
CQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLAYILGNQDTVQTQICELEETIR
HTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLSRLSAQIHEHQSLLDGS
GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL
LTELSFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRW
QRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDGRWG
ASRERLAISKDQRAVRSIPGLPLLLAAERLLTGCHLSVDVVLGDVAVTQGRSYWACAVDP
ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDAAVEALPPFAFLTIGMGK
ILLGSGASSNAGLTGRDGPTASCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDC
SGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD
Download sequence
Identical sequences Q7TNM2
10090.ENSMUSP00000036053 ENSMUSP00000036053 NP_898858.1.92730 ENSMUSP00000036053 ENSMUSP00000036053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]