SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000037055 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000037055
Domain Number 1 Region: 428-505,540-627
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-49
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 222-282
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-17
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Domain Number 3 Region: 7-52
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000012
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 180-212
Classification Level Classification E-value
Superfamily RING/U-box 0.0000544
Family IBR domain 0.09
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000037055
Domain Number - Region: 264-387
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0915
Family Apolipoprotein A-I 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000037055   Gene: ENSMUSG00000040365   Transcript: ENSMUST00000047145
Sequence length 630
Comment pep:known chromosome:NCBIM37:11:48619906:48630855:-1 gene:ENSMUSG00000040365 transcript:ENSMUST00000047145
Sequence
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD
REEEEEEVGEEEEVEAVGAGGGWDTPMREEDYEGDMEEEAEEEEEVFWSSGIGGSNWDNM
DYVWEEEEEEEEEELDYYLGDVADLRGEDEDEEEEVLEEDEEEELDPITQLPPPPAPRRC
FTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTPGRGSRVNEQGICPRHQEALKLFCEV
DEEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEERRVT
ELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAANRLEEQAAQL
SRLLAEAQERSQQGGLRLLQDIKETFNRCEEIQLQPPEIWSPDPCQPHSHDFLTDAIVRK
MSRMFCQAARVDLTLDPDTAHPALLLSPDRRGVRLAERRQEVPEHSKRFSADCCVLGAQG
FRSGRHYWEVEVGGRRGWAVGAARESTHHKEKVGSGGSSVSSGDASSSRHHHRRRRLHLP
QQLLLQREVWCVGTHGKRYQAQSSTEQTLLSPCEKPRRFGVYLDYEAGRLGFYNADTLAH
VHTFSAAFLGERVFPFFRVLSKGTRIKLCP
Download sequence
Identical sequences Q5NCC3
ENSMUSP00000037055 10090.ENSMUSP00000037055 ENSMUSP00000037055 NP_663352.2.92730 ENSMUSP00000037055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]