SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000037259 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000037259
Domain Number 1 Region: 1-219
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0092
Further Details:      
 
Domain Number 2 Region: 311-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000377
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000037259   Gene: ENSMUSG00000040181   Transcript: ENSMUST00000046049
Sequence length 532
Comment pep:known chromosome:NCBIM37:1:164759692:164796679:-1 gene:ENSMUSG00000040181 transcript:ENSMUST00000046049
Sequence
MVKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLYKSVVS
NSSREMSCYPDFPFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFA
VSGQWEVVTVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSFPGILTFKGEYFHSRQYKHPD
IFKDKRVLVVGMGNSGTDIAVEASHLAKKVFLSTTGGAWVISRVFDSGYPWDMIFMTRFQ
NMLRNLLPTPIVSWLISKKMNSWFNHVNYGVAPEDRTQLREPVLNDELPGRIITGKVFIK
PSIKEVKENSVVFNNTPKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LPKPTLAVIGLIKPLGSMVPTGETQARWVVQVLKGATTLPPPSVMMEEVNERKKNKHSGF
GLCYCKALQTDYITYIDDLLTSINAKPDLRAMLLTDPRLALSIFFGPCTPYHFRLTGPGK
WEGARKAILTQWDRTVKVTKTRTIQESPSSFETLLKLFSFLALLIAVFLIFL
Download sequence
Identical sequences P50285
ENSMUSP00000037259 ENSMUSP00000037259 NP_034361.1.92730 XP_006496725.1.92730 XP_006496726.1.92730 ENSMUSP00000037259 10090.ENSMUSP00000037259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]