SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000037628 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000037628
Domain Number 1 Region: 1379-1573,1612-1753
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-46
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000037628
Domain Number - Region: 1027-1060
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00293
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000037628   Gene: ENSMUSG00000038773   Transcript: ENSMUST00000043775
Sequence length 1762
Comment pep:known chromosome:NCBIM37:18:34936662:34999024:1 gene:ENSMUSG00000038773 transcript:ENSMUST00000043775
Sequence
MADAAASPVGKRLLLLFADPTASASASAPTAAAVVSGDPGPALRTRAWRAGTVRAMSGAV
PQDLAIFVEFDGCNWKQHSWVKVHAEDVLALLLEGSLVWAPRKDPVLLQGTRVPVAQWPA
LTFTPLVDKLGLGSVVPVEYLVDRELRFLSDANGMHLFQMGTDVQNQILLEHAALRETVN
ALISDQKLQEIFSRGPYSVQGHRVKVYQPEGEEVWLCGVVSRQDSVTRLMEVSITETGEV
KSVDPRLTHVMLMDSSTPQSEGGTIKAVKSSKGKKKRESIEGRDGRRRKSASDSGCDPAT
KKLKGDRGEVDSNGSDGGEASRGPWKGGNASGEPGLEQRAKQPPSTFVPQINRNIRFATY
TKENGRTLVVQDEPVGGDTPVPFTPYASATGQTPLAPEVGGAENKEAGKTLEQVSQGMVA
SAAVVTTASSTPTTVRISDTGLASGTGPEKQKGSWSQASGENSRNSSLASSGFGVSLSSL
SQPLTFGSGRSQSNGVLATDNKPLGFSFSCSSASESQKDSDLSKNLFFQCMSQNVPSTNY
LSRVSESVADDSSSRDSFTQSLESLTSGLCKGRSVLGADTQPGPKAGSSVDRKVPAESMP
TLTPAFPRSLLNTRTPENHENLFLQPPKLSREEPSNPFLAFVEKVEHSPFSSFVSQASGS
SSSATSVTSKATASWPESHSSAESAPLAKKKPLFITTDSSKLVSGVLGSALSTGSPSLSA
VGNGRSSSPTNSLTQPIEMPTLSSSPTEERPTVGPGQQDNPLLKTFSTVFGRHSGSFLSA
PAEFAQENKAPFEAVKRFSLDERSLACRQDSDSSTNSDLSDLSDSEEQLQAKSGLKGIPE
HLMGKLGPNGERSAELLLGKGKGKQAPKGRPRTAPLKVGQSVLKDVSKVRKLKQSGEPFL
QDGSCINVAPHLHKCRECRLERYRKFKEQEQDDSTVACRFFHFRRLVFTRKGVLRVEGFL
SPQQSDPDAMNLWIPSSSLAEGIDLETSKYILANVGDQFCQLVMSEKEAMMMVEPHQKVA
WKRAVRGVREMCDVCETTLFNIHWVCRKCGFGVCLDCYRLRKSRPRSETEEMGDEEVFSW
LKCAKGQSHEPENLMPTQIIPGTALYNIGDMVHAARGKWGIKANCPCISRQSKSVLRPAV
TNGISQLPSVTPSASSGNETTFSSGGGAAAVTNPEPDQVPKGAGTDGRSEEPLKAEGSAS
NSNSELKAIRPPCPDTAPPSSALHWLADLATQKAKEETKDAGSLRSVLNKESHSPFGLDS
FNSTAKVSPLTPKLFNSLLLGPTASNSKTEGSSLRDLLHSGPGKLPQTPLDTGIPFPPVF
SSSSAVAKSKASLPDFLDHIIASVVENKKTSDPSKRSCNLTDTQKEVKEMAMGLNVLDPH
TSHSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQPVLVSGVHKKLKSELWKPEAFSQEFG
DQDVDLVNCRNCAIISDVKVRDFWDGFEIICKRLRSEDGQPMVLKLKDWPPGEDFRDMMP
TRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNL
HLDVSDAVNVMVYVGIPVGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAA
KDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQILRKRLFEEYGVQGWAIVQFLGD
AVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNI
IYHAVKDAVGTLKAHESKLARS
Download sequence
Identical sequences B9EKS2
10090.ENSMUSP00000037628 ENSMUSP00000037628 ENSMUSP00000037628 ENSMUSP00000037628 NP_001074725.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]